PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G03198.1.p
Common NameEUGRSUZ_G03198
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YC
Protein Properties Length: 215aa    MW: 24226.1 Da    PI: 9.7587
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G03198.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC59.95.6e-196861898
             NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                      ++++P arikki++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +t++   ++ +v++ ++fdfl +iv r
  Eucgr.G03198.1.p  6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYEITLQRGAKTMNSLHLKHCVQSYNVFDFLREIVSR 86
                      5789*************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.2E-26372IPR009072Histone-fold
SuperFamilySSF471131.51E-20496IPR009072Histone-fold
PfamPF008081.3E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDRT YEITLQRGAK  60
TMNSLHLKHC VQSYNVFDFL REIVSRVPDY GHGHGHSDAV SEDRTVSRRR KATIDDGNDT  120
DEESKKSRMP ILAAVAEEEA VAEEEAAGVV AEPLRGRLRT MKLNHLSRPH LCNLSTRTLS  180
IKEQFQITAL SQRKLLRKLS QPLMVPSLER MVLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A7e-24272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G03198.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010067677.17e-91PREDICTED: dr1-associated corepressor
TrEMBLA0A059BJ021e-157A0A059BJ02_EUCGR; Uncharacterized protein
STRINGGLYMA15G36170.17e-80(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35062458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.15e-73nuclear factor Y, subunit C11